PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.159620.1
Common NameCsa_2G364580, LOC101213154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 348aa    MW: 37386.3 Da    PI: 6.9169
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.159620.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702225.78.8e-701142713153
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..aeaaskrkrel.......kskkqsalss 88 
                     +g+++CqdCGnqakkdCa+ RCRtCCksrgf+C+thvkstWvpaakrrerqqq aa+++++++++    ++skr re+        + ++sa+++
  Cucsa.159620.1 114 AGGMNCQDCGNQAKKDCAYLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQIAALQHQQQQEQfrGGDNSKRLRETqtataiaAAPTASASAC 208
                     6899*****************************************************99999998665566666666522222211222222233 PP

          DUF702  89 tklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                      +l+s +  + le +++P+ev+s+avfrcv+vs++dd++ee+aYqtav+igGhvfkGiLydqG+e
  Cucsa.159620.1 209 PRLPSIT--SGLELAQFPSEVNSPAVFRCVKVSAMDDADEEFAYQTAVNIGGHVFKGILYDQGPE 271
                     3333332..3455666***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.8E-68116271IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.5E-27118160IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.9E-27222270IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAGFFYLGGG REGPPNKQEE DEEEREQNLF LYRNDQEIYN KGFEIWPQQY NNNNNHQHQQ  60
PNPSLPNHLS FGVGPSRRSF MINDPSDEPS RSAFTLMRPA AAAFAAAAAS AATAGGMNCQ  120
DCGNQAKKDC AYLRCRTCCK SRGFQCQTHV KSTWVPAAKR RERQQQIAAL QHQQQQEQFR  180
GGDNSKRLRE TQTATAIAAA PTASASACPR LPSITSGLEL AQFPSEVNSP AVFRCVKVSA  240
MDDADEEFAY QTAVNIGGHV FKGILYDQGP ELRYTAAGES SSGHGGDGST HPLNLIAGPT  300
STSTSAATST NPAAASASTA PLLDPSIYPA PLNAFMAGTQ FFPPSRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152766.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ51e-89SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0A0LNQ50.0A0A0A0LNQ5_CUCSA; Uncharacterized protein
STRINGGLYMA14G40660.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-71SHI-related sequence 5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]